PDB entry 3hje

View 3hje on RCSB PDB site
Description: Crystal structure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase
Class: Transferase
Keywords: trehalose biosynthesis, maltooligoside trehalose synthase (MTSase), family 13 glycoside hydrolases, Sulfolobus tokodaii, tyrosine cluster, Transferase
Deposited on 2009-05-21, released 2010-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 704aa long hypothetical glycosyltransferase
    Species: Sulfolobus tokodaii str. 7 [TaxId:273063]
    Gene: ST0929
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hjea1, d3hjea2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hjeA (A:)
    mkllstyrlqpmkfseirnrldyfvelgvthlylspvlkarpgsthgydvvdyntindel
    ggeeeyirlideakskglgiiqdivpnhmavhhtnwrlmdvlkkgrhsryynyfdfyeee
    ekiripilgdrnfkityvndepyldyygnlfpindegrnylndiekllkvqyyelvdwrd
    ypsyrrffavneliavrqelewvfedshskilsfevdgyridhidglfkpeeylrrlknk
    ignkhifvekilsigeklrwdfidgttgydflnysnllftdnedkmteiyknildidlde
    lvketkkkiidtlfkhdierismmlgvnyeeikeflsclkvyrtyitendfrdeeiirnc
    sqkvyesmkknvtafmklqqympavfakayedtvlfiynrlislnevgsdlhyysiscdk
    fhefnlkrvgtlsfnatsthdtkfsedvrmrisaiseipdewakkvnewhnilnpnidkn
    deyrlyqtivgsfdgfnneykerlkahmikalreakvhtdwvnvnteyekkmtylidkmf
    nnekfmesflefeskidkmgkvkslslvalkitspgvadfyqglenfrylltdpdnrrpv
    vfselpkryeeglfnngrikayvtkvllnlrksmkdffinseykplklqkglcgfmrgdk
    vlvivktlnrdydieidgeytdvitdetvrgrvkvdklplilvk