PDB entry 3hjd

View 3hjd on RCSB PDB site
Description: x-ray structure of monomeric variant of hnp1
Deposited on 2009-05-21, released 2009-10-13
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Human neutrophil peptide 1
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59665 (0-29)
• Chain 'B':
  Compound: Human neutrophil peptide 1
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59665 (0-29)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >3hjdA (A:)
  acycripaciagerrygtciyqgrlwafcc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >3hjdB (B:)
  acycripaciagerrygtciyqgrlwafcc