PDB entry 3hj0

View 3hj0 on RCSB PDB site
Description: Transthyretin in complex with a covalent small molecule kinetic stabilizer
Class: hormone
Keywords: Hormone, Growth Factor, Amyloid, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Polyneuropathy, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A
Deposited on 2009-05-20, released 2009-12-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.149
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, Transthyretin, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hj0a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, Transthyretin, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3hj0b_
  • Heterogens: A93, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hj0A (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hj0A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hj0B (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hj0B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn