PDB entry 3hip

View 3hip on RCSB PDB site
Description: high-potential iron-sulfur protein from chromatium purpuratum
Deposited on 1998-06-15, released 1998-11-11
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-11, with a file datestamp of 1998-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3hipa_
  • Chain 'B':
    Domains in SCOP 1.55: d3hipb_
  • Chain 'C':
    Domains in SCOP 1.55: d3hipc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hipA (A:)
    vpanavtesdpaavalkyhrdaasservaaarpglppeeqhcencqfmnpdsaaadwkgc
    qlfpgklinlsgwcaswtlrag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hipB (B:)
    vpanavtesdpaavalkyhrdaasservaaarpglppeeqhcencqfmnpdsaaadwkgc
    qlfpgklinlsgwcaswtlr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hipC (C:)
    vpanavtesdpaavalkyhrdaasservaaarpglppeeqhcencqfmnpdsaaadwkgc
    qlfpgklinlsgwcaswtlrag