PDB entry 3hip

View 3hip on RCSB PDB site
Description: high-potential iron-sulfur protein from chromatium purpuratum
Class: electron transfer
Keywords: electron transfer, photosynthesis, metalloprotein
Deposited on 1998-06-15, released 1998-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high-potential iron-sulfur protein
    Species: Marichromatium purpuratum [TaxId:37487]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59860 (0-81)
      • conflict (11)
      • conflict (20)
      • conflict (22-23)
      • conflict (48)
      • conflict (51-52)
      • conflict (54-55)
      • conflict (57)
      • conflict (60)
      • conflict (70)
    Domains in SCOPe 2.08: d3hipa_
  • Chain 'B':
    Compound: high-potential iron-sulfur protein
    Species: Marichromatium purpuratum [TaxId:37487]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59860 (0-End)
      • conflict (11)
      • conflict (20)
      • conflict (22-23)
      • conflict (48)
      • conflict (51-52)
      • conflict (54-55)
      • conflict (57)
      • conflict (60)
      • conflict (70)
    Domains in SCOPe 2.08: d3hipb_
  • Chain 'C':
    Compound: high-potential iron-sulfur protein
    Species: Marichromatium purpuratum [TaxId:37487]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59860 (0-81)
      • conflict (11)
      • conflict (20)
      • conflict (22-23)
      • conflict (48)
      • conflict (51-52)
      • conflict (54-55)
      • conflict (57)
      • conflict (60)
      • conflict (70)
    Domains in SCOPe 2.08: d3hipc_
  • Heterogens: SF4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hipA (A:)
vpanavtesdpaavalkyhrdaasservaaarpglppeeqhcencqfmnpdsaaadwkgc
qlfpgklinlsgwcaswtlrag

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3hipB (B:)
vpanavtesdpaavalkyhrdaasservaaarpglppeeqhcencqfmnpdsaaadwkgc
qlfpgklinlsgwcaswtlrag

    Sequence, based on observed residues (ATOM records): (download) 
    >3hipB (B:)
vpanavtesdpaavalkyhrdaasservaaarpglppeeqhcencqfmnpdsaaadwkgc
qlfpgklinlsgwcaswtlr

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hipC (C:)
vpanavtesdpaavalkyhrdaasservaaarpglppeeqhcencqfmnpdsaaadwkgc
qlfpgklinlsgwcaswtlrag