PDB entry 3hil

View 3hil on RCSB PDB site
Description: SAM Domain of Human Ephrin Type-A Receptor 1 (EphA1)
Class: transferase
Keywords: ATP-BINDING, KINASE, NUCLEOTIDE-BINDING, RECEPTOR, TRANSFERASE, TYROSINE-PROTEIN KINASE, SIGNAL, STERILE ALPHA MOTIF, STRUCTURAL GENOMICS CONSORTIUM, SGC,, Glycoprotein, Membrane, Phosphoprotein, Polymorphism, Transmembrane
Deposited on 2009-05-20, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPH, EPHA1, EPHT, EPHT1, MGC163163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hila_
  • Chain 'B':
    Compound: Ephrin type-A receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPH, EPHA1, EPHT, EPHT1, MGC163163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hilb_
  • Heterogens: CL, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hilA (A:)
    mhhhhhhssgrenlyfqgdgipyrtvsewlesirmkryilhfhsagldtmecvleltaed
    ltqmgitlpghqkrilcsiqgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hilA (A:)
    gipyrtvsewlesirmkryilhfhsagldtmecvleltaedltqmgitlpghqkrilcsi
    qgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hilB (B:)
    mhhhhhhssgrenlyfqgdgipyrtvsewlesirmkryilhfhsagldtmecvleltaed
    ltqmgitlpghqkrilcsiqgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hilB (B:)
    ipyrtvsewlesirmkryilhfhsagldtmecvleltaedltqmgitlpghqkrilcsiq
    gf