PDB entry 3hi1

View 3hi1 on RCSB PDB site
Description: Structure of HIV-1 gp120 (core with V3) in Complex with CD4-Binding-Site Antibody F105
Class: STRUCTURAL PROTEIN/Immune System
Keywords: HIV, GP120, CD4 BINDING SITE ANTIBODY, F105, IMMUNE EVASION, AIDS, Apoptosis, Cell membrane, Cleavage on pair of basic residues, Disulfide bond, Envelope protein, Fusion protein, Glycoprotein, Host-virus interaction, Lipoprotein, Membrane, Palmitate, Transmembrane, Viral immunoevasion, Virion, STRUCTURAL PROTEIN-Immune System COMPLEX
Deposited on 2009-05-18, released 2009-11-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.204
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: f105 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI1 (0-214)
    Domains in SCOPe 2.05: d3hi1a1, d3hi1a2
  • Chain 'B':
    Compound: f105 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI1 (0-224)
  • Chain 'G':
    Compound: Glycoprotein 120
    Species: Human immunodeficiency virus type 1 [TaxId:362651]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35961 (0-33)
      • linker (34-35)
    • Uniprot P35961 (36-320)
    Domains in SCOPe 2.05: d3hi1g_
  • Chain 'H':
    Compound: f105 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI1 (0-224)
  • Chain 'J':
    Compound: Glycoprotein 120
    Species: Human immunodeficiency virus type 1 [TaxId:362651]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35961 (0-33)
      • linker (34-35)
    • Uniprot P35961 (36-320)
    Domains in SCOPe 2.05: d3hi1j_
  • Chain 'L':
    Compound: f105 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI1 (0-214)
    Domains in SCOPe 2.05: d3hi1l1, d3hi1l2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hi1A (A:)
    eivltqspgtlslsageratlscrasqsvssrylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrvepedfavyycqqydnsvctfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3hi1G (G:)
    tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
    failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
    tiivqlnesvvinctrpnnntrksinigpgralyttgeiigdirqahcnlsktqwentle
    qiaiklkeqfgnnktiifnpssggdpeivthsfncggeffycnstqlftwndtrklnntg
    rnitlpcrikqiinmwqevgkamyappirgqircssnitgllltrdggkdtngteifrpg
    ggdmrdnwrselykykvvkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hi1G (G:)
    tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
    failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
    tiivqlnesvvinctrpnnrqahcnlsktqwentleqiaiklkeqfgnnktiifnpssgg
    dpeivthsfncggeffycnstqlftwndrnitlpcrikqiinmwqevgkamyappirgqi
    rcssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvkie
    

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3hi1J (J:)
    tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
    failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
    tiivqlnesvvinctrpnnntrksinigpgralyttgeiigdirqahcnlsktqwentle
    qiaiklkeqfgnnktiifnpssggdpeivthsfncggeffycnstqlftwndtrklnntg
    rnitlpcrikqiinmwqevgkamyappirgqircssnitgllltrdggkdtngteifrpg
    ggdmrdnwrselykykvvkie
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hi1J (J:)
    tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
    failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
    tiivqlnesvvinctrpnnrqahcnlsktqwentleqiaiklkeqfgnnktiifnpssgg
    dpeivthsfncggeffycnstqlftwndrnitlpcrikqiinmwqevgkamyappirgqi
    rcssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvkie
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hi1L (L:)
    eivltqspgtlslsageratlscrasqsvssrylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrvepedfavyycqqydnsvctfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec