PDB entry 3hhw

View 3hhw on RCSB PDB site
Description: Complex of a vesicular stomatitis virus empty capsid with the nucleocapsid-binding domain of the phosphoprotein
Class: viral protein
Keywords: protein complex, template, replication, negative strand RNA virus, Chaperone, Phosphoprotein, RNA replication, Virion, Ribonucleoprotein, RNA-binding, Viral nucleoprotein, VIRAL PROTEIN
Deposited on 2009-05-18, released 2009-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.264
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: nucleocapsid protein, P
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Phosphoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: nucleocapsid protein, P
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Phosphoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: nucleocapsid protein, P
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Phosphoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: nucleocapsid protein, P
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Phosphoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: nucleocapsid protein, P
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: nucleoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N, phosphoprotein
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q77E03 (0-420)
      • engineered (288)
    Domains in SCOPe 2.07: d3hhwk_
  • Chain 'L':
    Compound: nucleoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N, phosphoprotein
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q77E03 (0-420)
      • engineered (288)
    Domains in SCOPe 2.07: d3hhwl_
  • Chain 'M':
    Compound: nucleoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N, phosphoprotein
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q77E03 (0-420)
      • engineered (288)
    Domains in SCOPe 2.07: d3hhwm_
  • Chain 'N':
    Compound: nucleoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N, phosphoprotein
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q77E03 (0-420)
      • engineered (288)
    Domains in SCOPe 2.07: d3hhwn_
  • Chain 'O':
    Compound: nucleoprotein
    Species: Vesicular stomatitis Indiana virus [TaxId:11277]
    Gene: N, phosphoprotein
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q77E03 (0-420)
      • engineered (288)
    Domains in SCOPe 2.07: d3hhwo_
  • Heterogens: TAR

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hhwK (K:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
    gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
    k
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hhwL (L:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
    gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
    k
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hhwM (M:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
    gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
    k
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hhwN (N:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
    gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
    k
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hhwO (O:)
    svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
    gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
    sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
    fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
    tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg
    qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
    gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
    k