PDB entry 3hht

View 3hht on RCSB PDB site
Description: A mutant of the nitrile hydratase from Geobacillus pallidus having enhanced thermostability
Class: lyase
Keywords: Alpha and beta proteins (a+b), LYASE
Deposited on 2009-05-17, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: 0.128
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase alpha subunit
    Species: Geobacillus pallidus [TaxId:33936]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hhta_
  • Chain 'B':
    Compound: Nitrile hydratase beta subunit
    Species: Geobacillus pallidus [TaxId:33936]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84FS6 (0-End)
      • engineered (35)
      • engineered (102)
      • engineered (126)
    Domains in SCOPe 2.07: d3hhtb_
  • Heterogens: 3CO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hhtA (A:)
    mtigqkntnidprfphhhprpqsfwearakaleslliekghlssdaiervikhyehelgp
    mngakvvakawtdpafkqrlledsetvlrelgyyglqgehirvventdtvhnvvvctlcs
    cypwpllglppswykepayrarvvkeprqvlkefgldlpdsveirvwdssseirfmvlpq
    rpegtegmteeelaklvtrdsmigvakieppkvtvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhtA (A:)
    idprfphhhprpqsfwearakaleslliekghlssdaiervikhyehelgpmngakvvak
    awtdpafkqrlledsetvlrelgyyglqgehirvventdtvhnvvvctlcscypwpllgl
    ppswykepayrarvvkeprqvlkefgldlpdsveirvwdssseirfmvlpqrpegtegmt
    eeelaklvtrdsmigvakiepp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hhtB (B:)
    mngihdvggmdgfgkvmyvkeeediyfthdwerlalglvagcmaqglgmkafdefrigie
    lmrpvdyltssyyghwiatvaynlvdtgvldekeldertevfskkpdtkiprredpalvk
    lvekalndglsplreisasprfkvgeriktknihptghtrfpryardkygvidevygahv
    fpddaahrkgenpqylyrvrfeaeelwgykqkdsvyidlwesymepvsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hhtB (B:)
    mngihdvggmdgfgkvmyvkeeediyfthdwerlalglvagcmaqglgmkafdefrigie
    lmrpvdyltssyyghwiatvaynlvdtgvldekeldertevfskkpdtkiprredpalvk
    lvekalndglsplreisasprfkvgeriktknihptghtrfpryardkygvidevygahv
    fpddaahrkgenpqylyrvrfeaeelwgykqkdsvyidlwesymepv