PDB entry 3hh8

View 3hh8 on RCSB PDB site
Description: Crystal Structure and metal binding properties of the lipoprotein MtsA
Class: metal binding protein
Keywords: Lipoprotein, Metal binding, Cell membrane, Copper transport, Ion transport, Iron, Iron transport, Membrane, Metal-binding, Palmitate, Transport, Zinc transport, METAL BINDING PROTEIN
Deposited on 2009-05-15, released 2009-06-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.173
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metal ABC transporter substrate-binding lipoprotein
    Species: Streptococcus pyogenes serotype M1 [TaxId:301447]
    Gene: mtsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4G4 (Start-293)
      • see remark 999 (60)
    Domains in SCOPe 2.06: d3hh8a_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hh8A (A:)
    giprnsstgaktaksdklkvvatnsiiadmtkaiagdkidlhsivpigqdpheyeplped
    aektsnadvifynginledggqawftklvknaqktknkdyfavsdgidviylegasekgk
    edphawlnlengiiyskniakqliakdpknketyeknlkayvaklekldkeakskfdaia
    enkklivtsegcfkyfskaygvpsayiweinteeegtpdqisslieklkvikpsalfves
    svdrrpmetvskdsgipiyseiftdsiakkgkpgdsyyammkwnldkiseglak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hh8A (A:)
    sdklkvvatnsiiadmtkaiagdkidlhsivpigqdpheyeplpedaektsnadvifyng
    inledggqawftklvknaqktknkdyfavsdgidviylegasekgkedphawlnlengii
    yskniakqliakdpknketyeknlkayvaklekldkeakskfdaiaenkklivtsegcfk
    yfskaygvpsayiweinteeegtpdqisslieklkvikpsalfvessvdrrpmetvskds
    gipiyseiftdsiakkgkpgdsyyammkwnldkiseglak