PDB entry 3hh7

View 3hh7 on RCSB PDB site
Description: Structural and Functional Characterization of a Novel Homodimeric Three-finger Neurotoxin from the Venom of Ophiophagus hannah (King Cobra)
Class: toxin
Keywords: haditoxin, Three finger toxin, Ophiophagus hannah, snake venom, neurotoxin, nicotinic acetylcholine receptors, Acetylcholine receptor inhibitor, Disulfide bond, Postsynaptic neurotoxin, Secreted, Toxin
Deposited on 2009-05-15, released 2010-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muscarinic toxin-like protein 3 homolog
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hh7a_
  • Chain 'B':
    Compound: Muscarinic toxin-like protein 3 homolog
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hh7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hh7A (A:)
    tkcynhqsttpetteicpdsgyfcyksswidgregriergctftcpeltpngkyvyccrr
    dkcnq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hh7B (B:)
    tkcynhqsttpetteicpdsgyfcyksswidgregriergctftcpeltpngkyvyccrr
    dkcnq