PDB entry 3hh4

View 3hh4 on RCSB PDB site
Description: New azaborine compounds bind to the T4 lysozyme L99A cavity - Benzene as control
Class: hydrolase
Keywords: azaborine, T4 lysozyme, ligand binding, hydrophobic cavity, Antimicrobial, Bacteriolytic enzyme, Glycosidase, Hydrolase
Deposited on 2009-05-14, released 2009-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (53)
      • engineered (96)
      • engineered (98)
    Domains in SCOPe 2.08: d3hh4a_
  • Heterogens: HED, PO4, BNZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hh4A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl