PDB entry 3hh3

View 3hh3 on RCSB PDB site
Description: New azaborine compounds bind to the T4 lysozyme L99A cavity - 1,2-dihydro-1,2-azaborine
Class: hydrolase
Keywords: azaborine, T4 lysozyme, ligand binding, hydrophobic cavity, Antimicrobial, Bacteriolytic enzyme, Glycosidase, Hydrolase
Deposited on 2009-05-14, released 2009-10-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.167
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Enterobacteria phage T4 [TaxId:10665]
  Gene: E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • engineered (53)
    • engineered (96)
    • engineered (98)
  Domains in SCOPe 2.03: d3hh3a_
• Heterogens: HED, PO4, NA, B20, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hh3A (A:)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl