PDB entry 3hh2

View 3hh2 on RCSB PDB site
Description: Crystal structure of the myostatin:follistatin 288 complex
Class: signaling protein/cytokine
Keywords: protein-protein complex, TB domain, cystine knot motif, TGF-beta fold, disulfide linked dimer, follistatin domain (FSD), Cleavage on pair of basic residues, Cytokine, Disulfide bond, Glycoprotein, Growth factor, Secreted, SIGNALING PROTEIN-CYTOKINE COMPLEX
Deposited on 2009-05-14, released 2009-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth/differentiation factor 8
    Species: Mus musculus [TaxId:10090]
    Gene: Mstn, Gdf8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hh2a_
  • Chain 'B':
    Compound: Growth/differentiation factor 8
    Species: Mus musculus [TaxId:10090]
    Gene: Mstn, Gdf8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hh2b_
  • Chain 'C':
    Compound: Follistatin
    Species: Homo sapiens [TaxId:9606]
    Gene: FST
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Follistatin
    Species: Homo sapiens [TaxId:9606]
    Gene: FST
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hh2A (A:)
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl
vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hh2B (B:)
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl
vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.