PDB entry 3hgx

View 3hgx on RCSB PDB site
Description: Crystal Structure of Pseudomonas aeruginosa Isochorismate-Pyruvate Lyase K42A mutant in complex with salicylate and pyruvate
Class: lyase
Keywords: siderophore biosynthesis, pyochelin, isochorismate-pyruvate lyase, chorismate mutase, PchB, Lyase
Deposited on 2009-05-14, released 2009-06-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salicylate biosynthesis protein pchB
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pchB, PA4230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51507 (0-98)
      • engineered (41)
    Domains in SCOPe 2.01: d3hgxa_
  • Chain 'B':
    Compound: Salicylate biosynthesis protein pchB
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pchB, PA4230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51507 (0-98)
      • engineered (41)
    Domains in SCOPe 2.01: d3hgxb_
  • Heterogens: SAL, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hgxA (A:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfaaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hgxA (A:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfaaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hgxB (B:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfaaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrgaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hgxB (B:)
    mktpedctgladireaidridldivqalgrrmdyvkaasrfaaseaaipapervaamlpe
    rarwaeengldapfveglfaqiihwyiaeqikywrqtrg