PDB entry 3hgp

View 3hgp on RCSB PDB site
Description: Structure of porcine pancreatic elastase complexed with a potent peptidyl inhibitor FR130180 determined by high resolution crystallography
Class: hydrolase
Keywords: Chymotrypsin Family, Hydrolase, Serine Protease, Calcium, Disulfide bond, Metal-binding, Protease, Secreted, Zymogen
Deposited on 2009-05-14, released 2009-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: 0.106
AEROSPACI score: 1.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hgpa_
  • Heterogens: FRW, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hgpA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn