PDB entry 3hgl

View 3hgl on RCSB PDB site
Description: crystal of AvrPtoB 121-205
Deposited on 2009-05-14, released 2009-06-23
The last revision was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.235
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Effector protein hopAB2
    Species: Pseudomonas syringae pv. tomato [TaxId:323]
    Gene: hopAB2, avrPtoB, PSPTO_3087
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3hglA (A:)
prrgavahansivqqlvsegadishtrnmlrnamngdavafsrveqnifrqhfpnmpmhg
isrdselaielrgalrravhqqaas

    Sequence, based on observed residues (ATOM records):
    >3hglA (A:)
gavahansivqqlvsegadishtrnmlrnamngdavafsrveqnifrqhfpnmpmhgisr
dselaielrgalrravhq