PDB entry 3hg6

View 3hg6 on RCSB PDB site
Description: Crystal Structure of the Recombinant Onconase from Rana pipiens
Class: hydrolase
Keywords: alpha and beta protein, Endonuclease, Hydrolase, Nuclease
Deposited on 2009-05-13, released 2010-05-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Onconase
  Species: Rana pipiens [TaxId:8404]
  Gene: rpr
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8UVX5 (1-103)
    • expression tag (0)
  Domains in SCOPe 2.03: d3hg6a_
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hg6A (A:)
  edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
  sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc