PDB entry 3hg2

View 3hg2 on RCSB PDB site
Description: Human alpha-galactosidase catalytic mechanism 1. Empty active site
Class: hydrolase
Keywords: GLYCOPROTEIN, CARBOHYDRATE-BINDING PROTEIN, GLYCOSIDASE, LYSOSOMAL ENZYME, (BETA/ALPHA)8 BARREL, Disease mutation, Disulfide bond, Hydrolase, Lysosome
Deposited on 2009-05-13, released 2009-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hg2a1, d3hg2a2
  • Chain 'B':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hg2b1, d3hg2b2
  • Heterogens: NAG, FUC, BMA, SO4, ACY, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hg2A (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hg2A (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hg2B (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hg2B (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmq