PDB entry 3hg0

View 3hg0 on RCSB PDB site
Description: Crystal structure of a DARPin in complex with ORF49 from Lactococcal phage TP901-1
Class: protein binding
Keywords: protein binding
Deposited on 2009-05-13, released 2009-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baseplate protein
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, bppL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163-168)
    Domains in SCOPe 2.06: d3hg0a1, d3hg0a2
  • Chain 'B':
    Compound: Baseplate protein
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, bppL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hg0b1
  • Chain 'C':
    Compound: Baseplate protein
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp, bppL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hg0c1, d3hg0c2
  • Chain 'D':
    Compound: Designed Ankyrin Repeat Protein (DARPin) 20
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HG0
    Domains in SCOPe 2.06: d3hg0d1, d3hg0d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hg0A (A:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hg0A (A:)
    gnvvhktgdetiagkktftgnvevngsltlptkswsgelgggiilslrkkgttveysigg
    eisssilansnlvnrsvpnefcprnrcslvghmvggwnafhidipssgvcqwfgptassg
    tprgtgtypidhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hg0B (B:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hg0B (B:)
    nvvhktgdetiagkktftgnvevngsltlptkswsgelgggiilslrkkgttveysigge
    isssilansnlvnrsvpnefcprnrcslvghmvggwnafhidipssgvcqwfgptassgt
    prgtgtypid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hg0C (C:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hg0C (C:)
    ggnvvhktgdetiagkktftgnvevngsltlptkswsgelgggiilslrkkgttveysig
    geisssilansnlvnrsvpnefcprnrcslvghmvggwnafhidipssgvcqwfgptass
    gtprgtgtypid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hg0D (D:)
    mrgshhhhhhgsdlgkklleaaragqddevrilmangadvnaedkvgltplhlaamndhl
    eivevllkngadvnaidaigetplhlvamyghleivevllkhgadvnaqdkfgktafdis
    idngnedlaeilqkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hg0D (D:)
    sdlgkklleaaragqddevrilmangadvnaedkvgltplhlaamndhleivevllknga
    dvnaidaigetplhlvamyghleivevllkhgadvnaqdkfgktafdisidngnedlaei
    lqkl