PDB entry 3hfi

View 3hfi on RCSB PDB site
Description: The crystal structure of the putative regulator from Escherichia coli CFT073
Class: structural genomics, unknown function
Keywords: regulator, structural geonomics, PSI, MCSG, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, DNA-binding, Transcription, Transcription regulation, unknown function
Deposited on 2009-05-11, released 2009-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative regulator
  Species: Escherichia coli O6 [TaxId:217992]
  Gene: c4276, GI:26250098
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8FCM7
  Domains in SCOPe 2.08: d3hfia_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3hfiA (A:)
  nvayplgegllsfaeslesqkihfttevitsriepanryvaeklritpgqdilylerlrs
  igdekamlienrinielcpgiveidfnqhnlfptieslskrkirysesryaarlignerg
  hfldisedapvlhleqlvffsrelpvefgnvwlkgnkyylgtvlqrrels
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3hfiA (A:)
  ttevitsriepanryvaeklritpgqdilylerlrsigdekamlienrinielcpgivei
  dfnqhnlfptieslskrkirysesryaarlignerghfldisedapvlhleqlvffsrel
  pvefgnvwlkgnkyylg