PDB entry 3hf7

View 3hf7 on RCSB PDB site
Description: the crystal structure of a cbs-domain pair with bound amp from klebsiella pneumoniae to 2.75a
Deposited on 2009-05-11, released 2009-05-26
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized CBS-domain protein
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: yfjD, KPN78578_28800, KPN_02935
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3hf7A (A:)
kvsvndimvprneivgidinddwksivrqlthsphgrivlyrdslddaismlrvreayrl
mtekkeftkeimlraadeiyfvpegtplstqlvkfqrnkkkvglvvdeygdiqglvtved
ileeivgdft

    Sequence, based on observed residues (ATOM records):
    >3hf7A (A:)
kvsvndimvprneivgidinddwksivrqlthsphgrivlyrdslddaismlrvreayrl
mtekkeftkeimlraadeiyfvpegtplstqlvkfqrnkkkvglvvdeygdiqglvtved
ileeivg