PDB entry 3hf5

View 3hf5 on RCSB PDB site
Description: Crystal structure of 4-methylmuconolactone methylisomerase in complex with 3-methylmuconolactone
Class: isomerase
Keywords: ferredoxin, ferredoxin-like fold, beta-barrel, isomerase, 4-methylmuconolactone methylisomerase, biodegradation, ortho-cleavage
Deposited on 2009-05-11, released 2009-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.179
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-methylmuconolactone methylisomerase
    Species: Pseudomonas reinekei [TaxId:395598]
    Gene: mmlI
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5MR76 (9-115)
      • expression tag (1-8)
    Domains in SCOPe 2.07: d3hf5a1, d3hf5a2
  • Chain 'B':
    Compound: 4-methylmuconolactone methylisomerase
    Species: Pseudomonas reinekei [TaxId:395598]
    Gene: mmlI
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5MR76 (9-115)
      • expression tag (0-8)
    Domains in SCOPe 2.07: d3hf5b1, d3hf5b2
  • Chain 'C':
    Compound: 4-methylmuconolactone methylisomerase
    Species: Pseudomonas reinekei [TaxId:395598]
    Gene: mmlI
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5MR76 (9-115)
      • expression tag (6-8)
    Domains in SCOPe 2.07: d3hf5c1, d3hf5c2
  • Chain 'D':
    Compound: 4-methylmuconolactone methylisomerase
    Species: Pseudomonas reinekei [TaxId:395598]
    Gene: mmlI
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5MR76 (9-115)
      • expression tag (7-8)
    Domains in SCOPe 2.07: d3hf5d1, d3hf5d2
  • Heterogens: 3ML, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hf5A (A:)
    pqfekiegrmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdt
    hvpyldvgridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf5A (A:)
    qfekiegrmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdth
    vpyldvgridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hf5B (B:)
    pqfekiegrmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdt
    hvpyldvgridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hf5C (C:)
    pqfekiegrmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdt
    hvpyldvgridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf5C (C:)
    egrmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdthvpyld
    vgridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hf5D (D:)
    pqfekiegrmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdt
    hvpyldvgridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf5D (D:)
    grmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdthvpyldv
    gridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv