PDB entry 3hf1

View 3hf1 on RCSB PDB site
Description: Crystal structure of human p53R2
Class: oxidoreductase
Keywords: p53 inducible, ribonucleotide reductase small subunit, Disease mutation, DNA damage, DNA repair, DNA replication, Iron, Metal-binding, Nucleus, Oxidoreductase
Deposited on 2009-05-10, released 2009-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.221
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleoside-diphosphate reductase subunit m2 b
    Species: Homo sapiens [TaxId:9606]
    Gene: RRM2B, P53R2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ribonucleoside-diphosphate reductase subunit m2 b
    Species: Homo sapiens [TaxId:9606]
    Gene: RRM2B, P53R2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hf1b_
  • Heterogens: FE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hf1B (B:)
    mgdperpeaagldqdersssdtneseiksneepllrkssrrfvifpiqypdiwkmykqaq
    asfwtaeevdlskdlphwnklkadekyfishilaffaasdgivnenlverfsqevqvpea
    rcfygfqilienvhsemysllidtyirdpkkreflfnaietmpyvkkkadwalrwiadrk
    stfgervvafaavegvffsgsfaaifwlkkrglmpgltfsnelisrdeglhcdfaclmfq
    ylvnkpseervreiivdavkieqefltealpvgligmncilmkqyiefvadrllvelgfs
    kvfqaenpfdfmenislegktnffekrvseyqrfavmaettdnvftldadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hf1B (B:)
    neepllrkssrrfvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadekyfi
    shilaffaasdgivnenlverfsqevqvpearcfygfqilienvhsemysllidtyirdp
    kkreflfnaimpyvkkkadwalrwiadrkstfgervvafaavegvffsgsfaaifwlkkr
    glmpgltfsnelisrdeglhcdfaclmfqylvnkpseervreiivdavkieqefltealp
    vgligmncilmkqyiefvadrllvelgfskvfqaenpfdfmenisl