PDB entry 3hej

View 3hej on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS T62R at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, domain swapping, arginine, Calcium, Endonuclease, Membrane, Metal-binding, Nuclease, Secreted, Zymogen
Deposited on 2009-05-08, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • engineered (43-44)
      • engineered (55)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.07: d3heja_
  • Chain 'B':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • engineered (43-44)
      • engineered (55)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.07: d3hejb_
  • Chain 'C':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • engineered (43-44)
      • engineered (55)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.07: d3hejc_
  • Chain 'D':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • engineered (43-44)
      • engineered (55)
      • engineered (110)
      • engineered (117)
      • engineered (121)
    Domains in SCOPe 2.07: d3hejd_
  • Heterogens: THP, MPD, GOL, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hejA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafrkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hejA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafrkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hejB (B:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafrkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hejB (B:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafrkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniws
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hejC (C:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafrkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hejC (C:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafrkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniws
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hejD (D:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafrkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hejD (D:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafrkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniws