PDB entry 3heg

View 3heg on RCSB PDB site
Description: P38 in complex with Sorafenib
Class: transferase
Keywords: Transferases, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-05-08, released 2009-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.24
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hega_
  • Heterogens: BAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hegA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
    trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
    ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
    hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hegA (A:)
    rptfyrqelnktiwevperyqnlspvygsvcaafdtktglrvavkklsrpfqsiihakrt
    yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgyvatrwyrapeimlnwmh
    ynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyi
    qsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepv
    adpydqsfesrdllidewksltydevisfvppp