PDB entry 3hec

View 3hec on RCSB PDB site
Description: P38 in complex with Imatinib
Class: transferase
Keywords: Transferase, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase
Deposited on 2009-05-08, released 2009-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3heca_
  • Heterogens: STI, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hecA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
    trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
    ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
    hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hecA (A:)
    rptfyrqelnktiwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrty
    relrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedcelkildfatrwyrapeimlnwmhynqt
    vdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqslt
    qmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpy
    dqsfesrdllidewksltydevisfvppp