PDB entry 3he2

View 3he2 on RCSB PDB site
Description: Crystal structure of enoyl-CoA hydratase from Mycobacterium tuberculosis
Class: lyase
Keywords: MYCOBACTERIUM TUBERCULOSIS, enoyl-CoA hydratase, Fatty acid metabolism, Lipid metabolism, Lyase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-05-07, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-CoA hydratase echA6
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA6, Rv0905, MT0928, MTCY31.33
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3he2a_
  • Chain 'B':
    Compound: enoyl-CoA hydratase echA6
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA6, Rv0905, MT0928, MTCY31.33
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3he2b_
  • Chain 'C':
    Compound: enoyl-CoA hydratase echA6
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA6, Rv0905, MT0928, MTCY31.33
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3he2c_
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3he2A (A:)
    mahhhhhhmgtleaqtqgpgsmigitqaeavltielqrperrnalnsqlveeltqairka
    gdgsaraivltgqgtafcagadlsgdafaadypdrlielhkamdaspmpvvgaingpaig
    aglqlamqcdlrvvapdaffqfptskyglaldnwsirrlsslvghgraramllsaeklta
    eialhtgmanrigtladaqawaaeiarlaplaiqhakrvlnddgaieeawpahkelfdka
    wgsqdvieaqvarmekrppkfqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3he2A (A:)
    migitqaeavltielqrperrnalnsqlveeltqairkasaraivltgqgtafcagadls
    gdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffqfpt
    skyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqawaae
    iarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkfqga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3he2B (B:)
    mahhhhhhmgtleaqtqgpgsmigitqaeavltielqrperrnalnsqlveeltqairka
    gdgsaraivltgqgtafcagadlsgdafaadypdrlielhkamdaspmpvvgaingpaig
    aglqlamqcdlrvvapdaffqfptskyglaldnwsirrlsslvghgraramllsaeklta
    eialhtgmanrigtladaqawaaeiarlaplaiqhakrvlnddgaieeawpahkelfdka
    wgsqdvieaqvarmekrppkfqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3he2B (B:)
    migitqaeavltielqrperrnalnsqlveeltqairkasaraivltgqgtafcagadls
    gdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffqfpt
    skyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqawaae
    iarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkfqga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3he2C (C:)
    mahhhhhhmgtleaqtqgpgsmigitqaeavltielqrperrnalnsqlveeltqairka
    gdgsaraivltgqgtafcagadlsgdafaadypdrlielhkamdaspmpvvgaingpaig
    aglqlamqcdlrvvapdaffqfptskyglaldnwsirrlsslvghgraramllsaeklta
    eialhtgmanrigtladaqawaaeiarlaplaiqhakrvlnddgaieeawpahkelfdka
    wgsqdvieaqvarmekrppkfqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3he2C (C:)
    migitqaeavltielqrperrnalnsqlveeltqairkasaraivltgqgtafcagadls
    afaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffqfptsk
    yglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqawaaeia
    rlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkfqga