PDB entry 3hdv

View 3hdv on RCSB PDB site
Description: Crystal structure of response regulator receiver protein from Pseudomonas putida
Class: transcription regulator
Keywords: Response regulator, PSI-II, 11224l, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, transcription regulator
Deposited on 2009-05-07, released 2009-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0355, PP0355
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hdva_
  • Chain 'B':
    Compound: Response regulator
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0355, PP0355
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88QX9 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3hdvb1, d3hdvb2
  • Chain 'C':
    Compound: Response regulator
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0355, PP0355
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hdvc_
  • Chain 'D':
    Compound: Response regulator
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0355, PP0355
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hdvd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hdvA (A:)
    mslvaarplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdl
    rmqpesgldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllel
    vnkelkigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdvA (A:)
    rplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlrmqpes
    gldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelvnkelk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hdvB (B:)
    mslvaarplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdl
    rmqpesgldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllel
    vnkelkigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdvB (B:)
    slvaarplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlr
    mqpesgldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelv
    nkelki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hdvC (C:)
    mslvaarplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdl
    rmqpesgldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllel
    vnkelkigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdvC (C:)
    vaarplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlrmq
    pesgldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelvnk
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hdvD (D:)
    mslvaarplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdl
    rmqpesgldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllel
    vnkelkigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdvD (D:)
    plvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlrmqpesg
    ldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelvnke