PDB entry 3hdp

View 3hdp on RCSB PDB site
Description: Crystal structure of the NI(II)-bound Glyoxalase-I from Clostridium acetobutylicum
Class: lyase
Keywords: Glutathione, Lyase, Glyoxalase, methylglyoxal, 11003p, PSI2, Structural genomic, NYSGXRC., Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
Deposited on 2009-05-07, released 2009-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyoxalase-I
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CAC2192, CA_C2192
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97H22 (3-132)
      • expression tag (4-5)
    Domains in SCOPe 2.08: d3hdpa_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hdpA (A:)
    gshmslkvhhigyavknidsalkkfkrlgyveesevvrdevrkvyiqfvinggyrvelva
    pdgedspinktikkgstpyhicyevediqksieemsqigytlfkkaeiapaidnrkvafl
    fstdigliellek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdpA (A:)
    shmslkvhhigyavknidsalkkfkrlgyveesevvrdevrkvyiqfvinggyrvelvap
    dgedspinktikkgstpyhicyevediqksieemsqigytlfkkaeiapaidnrkvaflf
    stdigliellek