PDB entry 3hdo

View 3hdo on RCSB PDB site
Description: Crystal Structure of a Histidinol-phosphate aminotransferase from Geobacter metallireducens
Class: transferase
Keywords: Transferase, PSI-II, 11246f, Histidinol-phosphate aminotransferase, Structural Genomics, Protein Structure Initiative, NYSGXRC, New York SGX Research Center for Structural Genomics, Amino-acid biosynthesis, Aminotransferase, Histidine biosynthesis, Pyridoxal phosphate
Deposited on 2009-05-07, released 2009-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.185
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidinol-phosphate aminotransferase
    Species: Geobacter metallireducens GS-15 [TaxId:269799]
    Gene: hisC, Gmet_0385
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39YP6 (3-351)
      • expression tag (352)
    Domains in SCOPe 2.07: d3hdoa1, d3hdoa2
  • Chain 'B':
    Compound: Histidinol-phosphate aminotransferase
    Species: Geobacter metallireducens GS-15 [TaxId:269799]
    Gene: hisC, Gmet_0385
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hdob_
  • Heterogens: GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hdoA (A:)
    msliplrqniasmkgyipgyqppdiaswiklntnenpyppspevvkaileelgpdgaalr
    iypsassqklrevagelygfdpswiimangsdevlnnlirafaaegeeigyvhpsysyyg
    tlaevqgarvrtfgltgdfriagfperyegkvfflttpnaplgpsfpleyidelarrcag
    mlvldetyaefaesnalelvrrhenvvvtrtlsksyslagmriglaiarpeviaaldkir
    dhynldrlaqaacvaalrdqaylseccrriretrewfttelrsigydvipsqgnylfatp
    pdrdgkrvydglyarkvlvrhfsdpllahgmrisigtreemeqtlaalkeigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdoA (A:)
    iplrqniasmkgyipgyqppdiaswiklntnenpyppspevvkaileelgpdgaalriyp
    sassqklrevagelygfdpswiimangsdevlnnlirafaaegeeigyvhpsysyygtla
    evqgarvrtfgltgdfriagfperyegkvfflttpnaplgpsfpleyidelarrcagmlv
    ldetyaefaesnalelvrrhenvvvtrtlsksyslagmriglaiarpeviaaldkirdhy
    nldrlaqaacvaalrdqaylseccrriretrewfttelrsigydvipsqgnylfatppdr
    dgkrvydglyarkvlvrhfsdpllahgmrisigtreemeqtlaalkeige
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hdoB (B:)
    msliplrqniasmkgyipgyqppdiaswiklntnenpyppspevvkaileelgpdgaalr
    iypsassqklrevagelygfdpswiimangsdevlnnlirafaaegeeigyvhpsysyyg
    tlaevqgarvrtfgltgdfriagfperyegkvfflttpnaplgpsfpleyidelarrcag
    mlvldetyaefaesnalelvrrhenvvvtrtlsksyslagmriglaiarpeviaaldkir
    dhynldrlaqaacvaalrdqaylseccrriretrewfttelrsigydvipsqgnylfatp
    pdrdgkrvydglyarkvlvrhfsdpllahgmrisigtreemeqtlaalkeigeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdoB (B:)
    iplrqniasmkgyipgyqppdiaswiklntnenpyppspevvkaileelgpdgaalriyp
    sassqklrevagelygfdpswiimangsdevlnnlirafaaegeeigyvhpsysyygtla
    evqgarvrtfgltgdfriagfperyegkvfflttpnaplgpsfpleyidelarrcagmlv
    ldetyaefaesnalelvrrhenvvvtrtlsksyslagmriglaiarpeviaaldkirdhy
    nldrlaqaacvaalrdqaylseccrriretrewfttelrsigydvipsqgnylfatppdr
    dgkrvydglyarkvlvrhfsdpllahgmrisigtreemeqtlaalkeig