PDB entry 3hdk

View 3hdk on RCSB PDB site
Description: Crystal structure of chemically synthesized [Aib51/51']HIV-1 protease
Deposited on 2009-05-07, released 2010-04-28
The last revision was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: [Aib51/51']HIV-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3HDK (0-98)
  • Chain 'B':
    Compound: [Aib51/51']HIV-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3HDK (0-98)
  • Heterogens: 2NC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3hdkA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiagfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3hdkB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiagfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf