PDB entry 3hdd

View 3hdd on RCSB PDB site
Description: engrailed homeodomain dna complex
Deposited on 1998-07-13, released 1998-11-11
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-11, with a file datestamp of 1998-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3hdda_
  • Chain 'B':
    Domains in SCOP 1.55: d3hddb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hddA (A:)
    rtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hddB (B:)
    rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikk