PDB entry 3hdc

View 3hdc on RCSB PDB site
Description: The crystal structure of thioredoxin protein from Geobacter metallireducens
Class: oxidoreductase
Keywords: thioredoxin, Geobacter metallireducens, GS-15, ATCC53774, DSM 7210, 11211i, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, OXIDOREDUCTASE
Deposited on 2009-05-07, released 2009-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin family protein
    Species: Geobacter metallireducens GS-15 [TaxId:269799]
    Gene: Gmet_1383
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39VV7 (3-149)
      • expression tag (1-2)
      • expression tag (150)
    Domains in SCOPe 2.08: d3hdca1, d3hdca2, d3hdca3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3hdcA (A:)
mslapgkaesdaplvrtgalapnfklptlsgenkslaqyrgkivlvnfwaswcpycrdem
psmdrlvksfpkgdlvvlavnvekrfpekyrrapvsfnflsdatgqvqqryganrlpdtf
ivdrkgiirqrvtggiewdapkvvsylksleghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3hdcA (A:)
slapgkaesdaplvrtgalapnfklptlsgenkslaqyrgkivlvnfwaswcpycrdemp
smdrlvksfpkgdlvvlavnvekrfpekyrrapvsfnflsdatgqvqqryganrlpdtfi
vdrkgiirqrvtggiewdapkvvsylksle