PDB entry 3hda

View 3hda on RCSB PDB site
Description: PrtC methionine mutants: M226A_DESY
Class: hydrolase
Keywords: Met-turn, beta roll, metalloprotease, metzincin, Hydrolase, Metal-binding, Protease, Secreted, Zymogen
Deposited on 2009-05-07, released 2009-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: secreted protease C
    Species: Erwinia chrysanthemi [TaxId:556]
    Gene: prtc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hdap1, d3hdap2
  • Chain 'Z':
    Compound: Uncharacterized peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3HDA (0-5)
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3hdaP (P:)
    antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
    fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
    rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalgla
    hpgeynagegdpsyndavyaedsyqfsiasywgenetgadynghyggapmiddiaaiqrl
    yganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinl
    negsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagad
    tlyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgq
    evmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hdaP (P:)
    nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
    tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
    ygrqtftheighalglahpgynghyggapmiddiaaiqrlyganmttrtgdsvygfnsnt
    drdfytatdsskalifsvwdaggtdtfdfsgysnnqrinlnegsfsdvgglkgnvsiahg
    vtienaiggsgndilvgnsadnilqggagndvlyggagadtlyggagrdtfvygsgqdst
    vaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqevmlqwdaansitnlwlhea
    ghssvdflvrivgqaaqsdiiv
    

  • Chain 'Z':
    No sequence available.