PDB entry 3hd8

View 3hd8 on RCSB PDB site
Description: Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase
Class: hydrolase inhibitor/hydrolase
Keywords: TWO BETA-BARREL DOMAIN, BETA-JELLY ROLL, HYDROLASE INHIBITOR-HYDROLASE COMPLEX, PROTEIN-PROTEIN COMPLEX, Xylan degradation, Glycosidase, Hydrolase
Deposited on 2009-05-07, released 2009-06-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylanase inhibitor
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Gene: xynA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53IQ4 (0-End)
      • see remark 999 (0)
      • see remark 999 (162)
      • see remark 999 (313)
    Domains in SCOPe 2.04: d3hd8a_
  • Chain 'B':
    Compound: Endo-1,4-beta-xylanase A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xynA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18429 (Start-184)
      • see remark 999 (146)
    Domains in SCOPe 2.04: d3hd8b_
  • Chain 'C':
    Compound: Xylanase inhibitor
    Species: TRITICUM AESTIVUM [TaxId:4565]
    Gene: xynA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53IQ4 (0-End)
      • see remark 999 (0)
      • see remark 999 (162)
      • see remark 999 (313)
    Domains in SCOPe 2.04: d3hd8c_
  • Chain 'D':
    Compound: Endo-1,4-beta-xylanase A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xynA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18429 (Start-184)
      • see remark 999 (146)
    Domains in SCOPe 2.04: d3hd8d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hd8A (A:)
    eglpvlapvtkdtatslytipfhdgaslvldvagllvwstceggqspaeiacssptclla
    naypapgcpapscgsdrhdkpctaypsnpvtgacaagslfhtrfaanttdgnkpvsevnv
    rvlaacapskllaslprgstgvaglagsglalpsqvasaqkvpnkfllclptggpgvaif
    gggplpwpqftqsmdytplvakggspahyisarsikventrvpiseralatggvmlstrl
    pyvllrrdvyrplvdaftkalaaqpangapvaravkpvapfelcydtktlgnnpggywvp
    nvlleldggsdwamtgknsmvdvkpgtacvafvemkgvdagdgsapavilggaqmedfvl
    dfdmekkrlgflrlphftgcssfnfarst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hd8A (A:)
    eglpvlapvtkdtatslytipfhdgaslvldvagllvwstcegaeiacssptcllanayp
    apgcpakpctaypsnpvtgacaagslfhtrfaanttdgnkpvsevnvrvlaacapsklla
    slprgstgvaglagsglalpsqvasaqkvpnkfllclptggpgvaifgggplpwpqftqs
    mdytplvakggspahyisarsikventrvpiseralatggvmlstrlpyvllrrdvyrpl
    vdaftkalaaqgapvaravkpvapfelcydtktlgnnpggywvpnvlleldggsdwamtg
    knsmvdvkpgtacvafvemkgvdagdgsapavilggaqmedfvldfdmekkrlgflrlph
    ftgcssfnfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hd8B (B:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hd8B (B:)
    stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
    gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
    rttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgssn
    vtvw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hd8C (C:)
    eglpvlapvtkdtatslytipfhdgaslvldvagllvwstceggqspaeiacssptclla
    naypapgcpapscgsdrhdkpctaypsnpvtgacaagslfhtrfaanttdgnkpvsevnv
    rvlaacapskllaslprgstgvaglagsglalpsqvasaqkvpnkfllclptggpgvaif
    gggplpwpqftqsmdytplvakggspahyisarsikventrvpiseralatggvmlstrl
    pyvllrrdvyrplvdaftkalaaqpangapvaravkpvapfelcydtktlgnnpggywvp
    nvlleldggsdwamtgknsmvdvkpgtacvafvemkgvdagdgsapavilggaqmedfvl
    dfdmekkrlgflrlphftgcssfnfarst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hd8C (C:)
    eglpvlapvtkdtatslytipfhdgaslvldvagllvwstcegeiacssptcllanaypa
    pgcpakpctaypsnpvtgacaagslfhtrfaanttdgnkpvsevnvrvlaacapskllas
    lprgstgvaglagsglalpsqvasaqkvpnkfllclptggpgvaifgggplpwpqftqsm
    dytplvakggspahyisarsikventrvpiseralatggvmlstrlpyvllrrdvyrplv
    daftkalaaqgapvaravkpvapfelcydtktlgnnpggywvpnvlleldggsdwamtgk
    nsmvdvkpgtacvafvemkgvdagdgsapavilggaqmedfvldfdmekkrlgflrlphf
    tgcssfnf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hd8D (D:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hd8D (D:)
    stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
    gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
    rttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgssn
    vtvw