PDB entry 3hd1

View 3hd1 on RCSB PDB site
Description: Crystal structure of E. coli HPPK(N10A) in complex with MgAMPCPP
Class: transferase
Keywords: alpha beta, ATP-binding, Folate biosynthesis, Kinase, Nucleotide-binding, Transferase
Deposited on 2009-05-06, released 2010-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  Species: Escherichia coli K-12 [TaxId:83333]
  Gene: b0142, foIK, folK, JW0138
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
    • engineered (9)
  Domains in SCOPe 2.08: d3hd1a_
• Heterogens: MG, APC, CL, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hd1A (A:)
  tvayiaigsalaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw