PDB entry 3hcz

View 3hcz on RCSB PDB site
Description: The crystal structure of a domain of possible thiol-disulfide isomerase from Cytophaga hutchinsonii ATCC 33406.
Class: structural genomics, unknown function
Keywords: APC61559.2, thiol-disulfide isomerase, Cytophaga hutchinsonii ATCC, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, Isomerase, unknown function
Deposited on 2009-05-06, released 2009-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.181
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Possible thiol-disulfide isomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU_0134, Cytophaga hutchinsonii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q11YT9 (3-147)
      • expression tag (1-2)
    Domains in SCOPe 2.08: d3hcza1, d3hcza2
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hczA (A:)
    snaplllgkkapnlymtdttgtyrylydvqakytilffwdsqcghcqqetpklydwwlkn
    rakgiqvyaanierkdeewlkfirskkiggwlnvrdsknhtdfkitydiyatpvlyvldk
    nkviiakrigyenlddflvqyekslktk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hczA (A:)
    naplllgkkapnlymtdttgtyrylydvqakytilffwdsqcghcqqetpklydwwlknr
    akgiqvyaanierkdeewlkfirskkiggwlnvrdsknhtdfkitydiyatpvlyvldkn
    kviiakrigyenlddflvqyekslktk