PDB entry 3hcx

View 3hcx on RCSB PDB site
Description: Crystal structure of E. coli HPPK(N10A)
Class: transferase
Keywords: alpha beta, ATP-binding, Folate biosynthesis, Kinase, Nucleotide-binding, Transferase
Deposited on 2009-05-06, released 2010-05-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.186
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b0142, foIK, folK, JW0138
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26281 (0-157)
      • engineered (9)
    Domains in SCOPe 2.01: d3hcxa_
  • Heterogens: CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hcxA (A:)
    tvayiaigsalaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
    etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
    rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw