PDB entry 3hcx

View 3hcx on RCSB PDB site
Description: Crystal structure of E. coli HPPK(N10A)
Class: transferase
Keywords: alpha beta, ATP-binding, Folate biosynthesis, Kinase, Nucleotide-binding, Transferase
Deposited on 2009-05-06, released 2010-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  Species: Escherichia coli K-12 [TaxId:83333]
  Gene: b0142, foIK, folK, JW0138
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
    • engineered (9)
  Domains in SCOPe 2.08: d3hcxa_
• Heterogens: CL, TRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hcxA (A:)
  tvayiaigsalaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw