PDB entry 3hcu

View 3hcu on RCSB PDB site
Description: Crystal structure of TRAF6 in complex with Ubc13 in the C2 space group
Class: signaling protein/ligase
Keywords: cross-brace, beta-beta-alpha, Coiled coil, Cytoplasm, Metal-binding, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger, ATP-binding, DNA damage, DNA repair, Isopeptide bond, Ligase, Nucleotide-binding, SIGNALING PROTEIN/LIGASE COMPLEX
Deposited on 2009-05-06, released 2009-05-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.256
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TNF receptor-associated factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF85, TRAF6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3hcub_
  • Chain 'C':
    Compound: TNF receptor-associated factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF85, TRAF6
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: BLU, UBE2N
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3hcud_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hcuB (B:)
    gshmaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelf
    lpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnp
    ddplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hcuB (B:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamnni
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hcuD (D:)
    gshmaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelf
    lpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnp
    ddplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hcuD (D:)
    aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
    ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
    andvaeqwktneaqaietarawtrlyamn