PDB entry 3hct

View 3hct on RCSB PDB site
Description: Crystal structure of TRAF6 in complex with Ubc13 in the P1 space group
Class: signaling protein/ligase
Keywords: cross-brace, beta-beta-alpha, Coiled coil, Cytoplasm, Metal-binding, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger, ATP-binding, DNA damage, DNA repair, Isopeptide bond, Ligase, Nucleotide-binding, SIGNALING PROTEIN-LIGASE COMPLEX
Deposited on 2009-05-06, released 2009-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: TNF receptor-associated factor 6
  Species: Homo sapiens [TaxId:9606]
  Gene: RNF85, TRAF6
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y4K3
• Chain 'B':
  Compound: Ubiquitin-conjugating enzyme E2 N
  Species: Homo sapiens [TaxId:9606]
  Gene: BLU, UBE2N
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61088
  Domains in SCOPe 2.07: d3hctb_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3hctB (B:)
  gshmaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelf
  lpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnp
  ddplandvaeqwktneaqaietarawtrlyamnni
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3hctB (B:)
  lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
  maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
  dvaeqwktneaqaietarawtrlyamnn