PDB entry 3hct
View 3hct on RCSB PDB site
Description: Crystal structure of TRAF6 in complex with Ubc13 in the P1 space group
Class: signaling protein/ligase
Keywords: cross-brace, beta-beta-alpha, Coiled coil, Cytoplasm, Metal-binding, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger, ATP-binding, DNA damage, DNA repair, Isopeptide bond, Ligase, Nucleotide-binding, SIGNALING PROTEIN/LIGASE COMPLEX
Deposited on
2009-05-06, released
2009-05-26
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-09-08, with a file datestamp of
2009-09-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: TNF receptor-associated factor 6
Species: Homo sapiens [TaxId:9606]
Gene: RNF85, TRAF6
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Ubiquitin-conjugating enzyme E2 N
Species: Homo sapiens [TaxId:9606]
Gene: BLU, UBE2N
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3hctb_ - Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3hctB (B:)
gshmaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelf
lpeeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnp
ddplandvaeqwktneaqaietarawtrlyamnni
Sequence, based on observed residues (ATOM records): (download)
>3hctB (B:)
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddplan
dvaeqwktneaqaietarawtrlyamnn