PDB entry 3hco

View 3hco on RCSB PDB site
Description: Human ferrochelatase with Cd and protoporphyrin IX bound
Class: lyase
Keywords: ferrochelatase, metal selectivity, Disease mutation, Heme biosynthesis, Iron, Iron-sulfur, Lyase, Membrane, Metal-binding, Mitochondrion, Mitochondrion inner membrane, Porphyrin biosynthesis, Transit peptide
Deposited on 2009-05-06, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FECH, hemH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hcoa_
  • Chain 'B':
    Compound: Ferrochelatase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FECH, hemH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hcob_
  • Heterogens: FES, GOL, IMD, BCT, CHD, HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hcoA (A:)
    rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrrtpkiqeqyr
    rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
    aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
    ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
    vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
    irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hcoB (B:)
    rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrrtpkiqeqyr
    rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
    aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
    ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
    vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
    irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql