PDB entry 3hcm

View 3hcm on RCSB PDB site
Description: Crystal structure of human S100B in complex with S45
Class: metal binding protein
Keywords: S100B, calcium binding protein, inhibitor, Calcium, Cytoplasm, Metal-binding, Nucleus, METAL BINDING PROTEIN
Deposited on 2009-05-06, released 2010-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hcma_
  • Chain 'B':
    Compound: Protein S100-B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hcmb_
  • Heterogens: CA, S45, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hcmA (A:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hcmA (A:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hcmB (B:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hcmB (B:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldndgdgecdfqefmafvamvttacheffeh