PDB entry 3hck

View 3hck on RCSB PDB site
Description: NMR ensemble of the uncomplexed human HCK SH2 domain, 20 structures
Class: transferase
Keywords: hck, sh2, tyrosine kinase, signal transduction, transferase
Deposited on 1997-03-31, released 1997-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hck sh2
    Species: Homo sapiens [TaxId:9606]
    Gene: RESIDUES E119-K224 OF HUMAN HC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hcka1, d3hcka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hckA (A:)
meteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhy
kirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmssk