PDB entry 3hc9

View 3hc9 on RCSB PDB site
Description: Ferric Horse Heart Myoglobin; H64V mutant
Class: oxygen transport
Keywords: horse heart myoglobin, ferric, H64V mutant, Heme, Iron, Metal-binding, Muscle protein, Oxygen transport, Transport
Deposited on 2009-05-05, released 2009-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered (63)
    Domains in SCOPe 2.08: d3hc9a_
  • Heterogens: HEM, PO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hc9A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkvgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg