PDB entry 3hc0

View 3hc0 on RCSB PDB site
Description: BHA10 IgG1 wild-type Fab - antibody directed at human LTBR
Class: immune system
Keywords: igg1 fab, bha10, immune system
Deposited on 2009-05-05, released 2009-08-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin IgG1 Fab, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HC0 (0-End)
  • Chain 'B':
    Compound: immunoglobulin IgG1 Fab, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HC0 (0-212)
    Domains in SCOPe 2.04: d3hc0b1, d3hc0b2
  • Chain 'H':
    Compound: immunoglobulin IgG1 Fab, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HC0 (0-216)
  • Chain 'L':
    Compound: immunoglobulin IgG1 Fab, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HC0 (0-End)
    Domains in SCOPe 2.04: d3hc0l1, d3hc0l2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hc0B (B:)
    diqmtqspsslsasvgdrvtitckasqnvginvawyqqkpgkapkslissasyrysgvps
    rfsgsgsgtdftltisslqpedfatyfcqqydtypftfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3hc0L (L:)
    diqmtqspsslsasvgdrvtitckasqnvginvawyqqkpgkapkslissasyrysgvps
    rfsgsgsgtdftltisslqpedfatyfcqqydtypftfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hc0L (L:)
    diqmtqspsslsasvgdrvtitckasqnvginvawyqqkpgkapkslissasyrysgvps
    rfsgsgsgtdftltisslqpedfatyfcqqydtypftfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg