PDB entry 3hbx

View 3hbx on RCSB PDB site
Description: Crystal structure of GAD1 from Arabidopsis thaliana
Class: lyase
Keywords: Calmodulin-binding, Decarboxylase, Lyase, Pyridoxal phosphate
Deposited on 2009-05-05, released 2009-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate decarboxylase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g17330, GAD, GAD1, GDH1, MKP11.30, MKP11_18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hbxa_
  • Chain 'B':
    Compound: Glutamate decarboxylase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g17330, GAD, GAD1, GDH1, MKP11.30, MKP11_18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hbxb_
  • Chain 'C':
    Compound: Glutamate decarboxylase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g17330, GAD, GAD1, GDH1, MKP11.30, MKP11_18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hbxc_
  • Chain 'D':
    Compound: Glutamate decarboxylase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g17330, GAD, GAD1, GDH1, MKP11.30, MKP11_18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hbxd_
  • Chain 'E':
    Compound: Glutamate decarboxylase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g17330, GAD, GAD1, GDH1, MKP11.30, MKP11_18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hbxe_
  • Chain 'F':
    Compound: Glutamate decarboxylase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g17330, GAD, GAD1, GDH1, MKP11.30, MKP11_18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hbxf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hbxA (A:)
    mvlshavsesdvsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnl
    asfvttwmepecdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavg
    vgtvgsseaimlaglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelke
    vklsegyyvmdpqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtp
    ihvdaasggfiapflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeel
    ifhinylgadqptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglek
    terfnivskdegvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvv
    iredfsrtlaerlvidiekvmreldelpsrvihkislgqeksesnsdnlmvtvkksdidk
    qrdiitgwkkfvadrkktsgic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbxA (A:)
    vsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnlasfvttwmepe
    cdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavgvgtvgsseaim
    laglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelkevklsegyyvmd
    pqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtpihvdaasggfi
    apflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeelifhinylgadq
    ptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglekterfnivskde
    gvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvviredfsrtlae
    rlvidiekvmreldelp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hbxB (B:)
    mvlshavsesdvsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnl
    asfvttwmepecdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavg
    vgtvgsseaimlaglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelke
    vklsegyyvmdpqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtp
    ihvdaasggfiapflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeel
    ifhinylgadqptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglek
    terfnivskdegvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvv
    iredfsrtlaerlvidiekvmreldelpsrvihkislgqeksesnsdnlmvtvkksdidk
    qrdiitgwkkfvadrkktsgic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbxB (B:)
    vsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnlasfvttwmepe
    cdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavgvgtvgsseaim
    laglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelkevklsegyyvmd
    pqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtpihvdaasggfi
    apflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeelifhinylgadq
    ptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglekterfnivskde
    gvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvviredfsrtlae
    rlvidiekvmreldelp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hbxC (C:)
    mvlshavsesdvsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnl
    asfvttwmepecdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavg
    vgtvgsseaimlaglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelke
    vklsegyyvmdpqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtp
    ihvdaasggfiapflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeel
    ifhinylgadqptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglek
    terfnivskdegvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvv
    iredfsrtlaerlvidiekvmreldelpsrvihkislgqeksesnsdnlmvtvkksdidk
    qrdiitgwkkfvadrkktsgic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbxC (C:)
    vsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnlasfvttwmepe
    cdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavgvgtvgsseaim
    laglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelkevklsegyyvmd
    pqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtpihvdaasggfi
    apflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeelifhinylgadq
    ptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglekterfnivskde
    gvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvviredfsrtlae
    rlvidiekvmreldelp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hbxD (D:)
    mvlshavsesdvsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnl
    asfvttwmepecdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavg
    vgtvgsseaimlaglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelke
    vklsegyyvmdpqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtp
    ihvdaasggfiapflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeel
    ifhinylgadqptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglek
    terfnivskdegvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvv
    iredfsrtlaerlvidiekvmreldelpsrvihkislgqeksesnsdnlmvtvkksdidk
    qrdiitgwkkfvadrkktsgic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbxD (D:)
    vsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnlasfvttwmepe
    cdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavgvgtvgsseaim
    laglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelkevklsegyyvmd
    pqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtpihvdaasggfi
    apflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeelifhinylgadq
    ptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglekterfnivskde
    gvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvviredfsrtlae
    rlvidiekvmreldel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3hbxE (E:)
    mvlshavsesdvsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnl
    asfvttwmepecdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavg
    vgtvgsseaimlaglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelke
    vklsegyyvmdpqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtp
    ihvdaasggfiapflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeel
    ifhinylgadqptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglek
    terfnivskdegvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvv
    iredfsrtlaerlvidiekvmreldelpsrvihkislgqeksesnsdnlmvtvkksdidk
    qrdiitgwkkfvadrkktsgic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbxE (E:)
    vsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnlasfvttwmepe
    cdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavgvgtvgsseaim
    laglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelkevklsegyyvmd
    pqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtpihvdaasggfi
    apflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeelifhinylgadq
    ptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglekterfnivskde
    gvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvviredfsrtlae
    rlvidiekvmreldel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3hbxF (F:)
    mvlshavsesdvsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnl
    asfvttwmepecdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavg
    vgtvgsseaimlaglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelke
    vklsegyyvmdpqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtp
    ihvdaasggfiapflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeel
    ifhinylgadqptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglek
    terfnivskdegvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvv
    iredfsrtlaerlvidiekvmreldelpsrvihkislgqeksesnsdnlmvtvkksdidk
    qrdiitgwkkfvadrkktsgic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbxF (F:)
    vsvhstfasryvrtslprfkmpensipkeaayqiindelmldgnprlnlasfvttwmepe
    cdklimssinknyvdmdeypvttelqnrcvnmiahlfnapleeaetavgvgtvgsseaim
    laglafkrkwqnkrkaegkpvdkpnivtganvqvcwekfaryfevelkevklsegyyvmd
    pqqavdmvdenticvaailgstlngefedvkllndllveknketgwdtpihvdaasggfi
    apflypelewdfrlplvksinvsghkyglvyagigwviwrnkedlpeelifhinylgadq
    ptftlnfskgssqviaqyyqlirlghegyrnvmencrenmivlreglekterfnivskde
    gvplvafslkdsschtefeisdmlrrygwivpaytmppnaqhitvlrvviredfsrtlae
    rlvidiekvmreldelp