PDB entry 3hbv

View 3hbv on RCSB PDB site
Description: PrtC methionine mutants: M226A in-house
Class: hydrolase
Keywords: Met-turn, beta roll, zinc, metalloprotease, metzincin, Calcium, Hydrolase, Metal-binding, Protease, Secreted, Zymogen
Deposited on 2009-05-05, released 2009-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.153
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: secreted protease C
    Species: Erwinia chrysanthemi [TaxId:556]
    Gene: prtc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hbvp1, d3hbvp2
  • Chain 'Z':
    Compound: Uncharacterized peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3HBV (0-6)
  • Heterogens: CA, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3hbvP (P:)
    antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
    fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
    rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalgla
    hpgeynagegdpsyndavyaedsyqfsiasywgenetgadynghyggapmiddiaaiqrl
    yganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinl
    negsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagad
    tlyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgq
    evmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hbvP (P:)
    nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
    tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
    ygrqtftheighalglahynghyggapmiddiaaiqrlyganmttrtgdsvygfnsntdr
    dfytatdsskalifsvwdaggtdtfdfsgysnnqrinlnegsfsdvgglkgnvsiahgvt
    ienaiggsgndilvgnsadnilqggagndvlyggagadtlyggagrdtfvygsgqdstva
    aydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqevmlqwdaansitnlwlheagh
    ssvdflvrivgqaaqsdiiv
    

  • Chain 'Z':
    No sequence available.